XRCC2 (NM_005431) Human Recombinant Protein

CAT#: TP308330

Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2), 20 µg

Product Images

Coomassie blue staining of purified XRCC2 protein (Cat# TP308330). The protein was produced from HEK293T cells transfected with XRCC2 cDNA clone (Cat# RC208330) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208330 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS
  EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH
  PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS
  HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005422
• Locus ID: 7516
• UniProt ID: O43543, A0A384MEK2
• Cytogenetics: 7q36.1
• Refseq Size: 3094
• Refseq ORF: 840
• Synonyms: FANCU; POF17; SPGF50
• Summary: This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Homologous recombination