ZFP91 (NM_053023) Human Recombinant Protein

CAT#: TP308217

Recombinant protein of human zinc finger protein 91 homolog (mouse) (ZFP91), 20 µg

Product Images

Coomassie blue staining of purified ZFP91 protein (Cat# TP308217). The protein was produced from HEK293T cells transfected with ZFP91 cDNA clone (Cat# RC208217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC208217
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GGACRDH*QPRAEGRSGPRPGRCGRRRRSCVPPEEGRVSPPAEEQPQRQASRRPRAAAPGREVPVSSSGQ
  EESATPMHRKSNN**RSQGRKRGRRRFCPPSGSFHCCI*T*PGLA***DICFSPS*YREHPKLSVQDRFIAAHLQVR
  TKYRPT*L*CWRRASVSRWH**RGRGGGRRDVNQ*RGDTIQR*SKR*DLQTPLRKGNPKATEKIREGKRREGEEGN
  *SGSRGGGERRGE*N*RG*GTSKEERKKTKR*QKSTFTQKEKKASNPVCPL*DGRMWNCPCPSSLFAAPH*IPAFA
  EEEICMSPSLLWTTLQASEATSATCQTSYRSKGLYL*ILCSGLQEFPQSGSAPDDSHWREAITM*DLWIYL
  STKGIS*LAHEET*CRLLLPVFLQYLWQKI*EEGQRSGTQGKKPP*GADCRSSGCQCRRPHHQHRYLGH*PRVP
  DAAFRWSGSSSSS*ALGKLNLWRVPTVRS*RDVKVILQWDGTGEPDG*WEDLCGKRQQWRH*RAGYELRYTRC
  YHRGSD*RFRLCRT
  myc-FLAG tag
  
  Recombinant protein using RC208217 also available, TP308217M
• Tag: C-Myc/DDK
• Predicted MW: 63.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444251
• Locus ID: 80829
• UniProt ID: Q96JP5, A0A024R4Z1
• Cytogenetics: 11q12.1
• Refseq Size: 5735
• Refseq ORF: 1707
• Synonyms: DMS-8; DSM-8; DSM8; FKSG11; PZF; ZFP-91; ZNF757
• Summary: The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. [provided by RefSeq, Oct 2010]
• Protein Families: Transcription Factors