TBC1D26 (NM_178571) Human Recombinant Protein

CAT#: TP308210

Recombinant protein of human TBC1 domain family, member 26 (TBC1D26), 20 µg

Product Images

Coomassie blue staining of purified TBC1D26 protein (Cat# TP308210). The protein was produced from HEK293T cells transfected with TBC1D26 cDNA clone (Cat# RC208210) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208210 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEMDGDPYNLPAQGQGNIIITKYEQGHRAGAAVDLGHEQVDVRKYTNNLGIVHEMELPRVSALEVKQRRK
  ESKRTNKWQKMLADWTKYRSTKKLSQRVYKVIPLAVRGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSR
  IIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYNPEVGYHRDLSRITAILLLCLPEEDVFWAL
  TQLLAGERHSLWYSTAQILPGSRSSYRTRSRCCTSPSQRS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848666
• Locus ID: 353149
• UniProt ID: Q86UD7
• Cytogenetics: 17p12
• Refseq Size: 1883
• Refseq ORF: 750
• Summary: May act as a GTPase-activating protein for Rab family protein(s).[UniProtKB/Swiss-Prot Function]