OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSRB3 (NM_001031679) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308187
Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA803478 MSRB3 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MSRB3 or NM_001031679"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208187 protein sequence
Red=Cloning site Green=Tags(s)

MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH
HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD
DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001026849
Locus ID 253827
UniProt ID Q8IXL7
Cytogenetics 12q14.3
RefSeq Size 4434
RefSeq ORF 555
Synonyms DFNB74
Summary The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. provided by RefSeq, Jul 2010
Protein Categories Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSRB3" proteins (7)
SKU Description Size Price
PH308187 MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849) 10 ug
$3,360.00
PH316512 MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_932346) 10 ug
$3,360.00
LC403694 Lyophilized MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422222 Lyophilized MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403694 Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422222 Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP316512 Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products