MSRB3 (NM_001031679) Human Mass Spec Standard

SKU PH308187

MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208187]
• Predicted MW: 20 kDa
• Protein Sequence:
  Protein Sequence

  >RC208187 protein sequence; Red=Cloning site Green=Tags(s); ; MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH; HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD; DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001026849
• RefSeq Size: 4434
• RefSeq ORF: 555
• Synonyms: DFNB74
• Locus ID: 253827
• UniProt ID: Q8IXL7
• Cytogenetics: 12q14.3
• Summary: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010]