MSRB3 (NM_001031679) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208187] |
Predicted MW | 20 kDa |
Protein Sequence |
Protein Sequence
>RC208187 protein sequence
Red=Cloning site Green=Tags(s) MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001026849 |
RefSeq Size | 4434 |
RefSeq ORF | 555 |
Synonyms | DFNB74 |
Locus ID | 253827 |
UniProt ID | Q8IXL7 |
Cytogenetics | 12q14.3 |
Summary | The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH316512 | MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_932346) | 10 ug |
$3,255.00
|
|
LC403694 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422222 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403694 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 1 | 100 ug |
$436.00
|
|
LY422222 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 2 | 100 ug |
$436.00
|
|
TP308187 | Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP316512 | Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.