OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALA (NM_005402) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308076
Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RALA or NM_005402"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208076 protein sequence
Red=Cloning site Green=Tags(s)

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE
EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005393
Locus ID 5898
UniProt ID P11233
Cytogenetics 7p14.1
RefSeq Size 2828
RefSeq ORF 618
Synonyms HINCONS; RAL
Summary The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Pancreatic cancer, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALA" proteins (3)
SKU Description Size Price
PH308076 RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393) 10 ug
$3,360.00
LC417324 Lyophilized RALA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417324 Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products