OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFT52 (NM_016004) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308044
Recombinant protein of human intraflagellar transport 52 homolog (Chlamydomonas) (IFT52), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IFT52 or NM_016004"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208044 protein sequence
Red=Cloning site Green=Tags(s)

MEKELRSTILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEF
EILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREI
SRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGGKL
AVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQES
DEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPP
LELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKL
NQEHDIDTSETAFQNNF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057088
Locus ID 51098
UniProt ID Q9Y366
Cytogenetics 20q13.12
RefSeq Size 1675
RefSeq ORF 1311
Synonyms C20orf9; CGI-53; NGD2; NGD5
Summary This gene encodes a conserved proline-rich protein that is a component of the intraflagellar transport-B (IFT-B) core complex. The encoded protein is essential for the integrity of the IFT-B core complex, and for biosynthesis and maintenance of cilia. Mutations in this gene are associated with ciliopathy that affects the skeleton. provided by RefSeq, Oct 2016
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFT52" proteins (3)
SKU Description Size Price
PH308044 IFT52 MS Standard C13 and N15-labeled recombinant protein (NP_057088) 10 ug
$3,360.00
LC402484 Lyophilized IFT52 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402484 Transient overexpression lysate of intraflagellar transport 52 homolog (Chlamydomonas) (IFT52) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products