OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RACGAP1 (NM_013277) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307542
Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA811639 RACGAP1 mouse monoclonal antibody,clone OTI3A5 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RACGAP1 or NM_013277"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207542 protein sequence
Red=Cloning site Green=Tags(s)

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN
KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ
GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS
NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM
LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK
MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM
LK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 70.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037409
Locus ID 29127
UniProt ID Q9H0H5
Cytogenetics 12q13.12
RefSeq Size 3315
RefSeq ORF 1896
Synonyms CYK4; HsCYK-4; ID-GAP; MgcRacGAP
Summary This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. provided by RefSeq, Feb 2016
Protein Categories Cardiovascular diseases, Cytokines, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RACGAP1" proteins (11)
SKU Description Size Price
PH307542 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409) 10 ug
$3,360.00
PH326045 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) 10 ug
$3,360.00
PH326046 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) 10 ug
$3,360.00
LC402238 Lyophilized RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426645 Lyophilized RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426646 Lyophilized RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402238 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426645 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426646 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP326045 Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP326046 Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products