RACGAP1 (NM_013277) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207542] |
Predicted MW | 71 kDa |
Protein Sequence |
Protein Sequence
>RC207542 protein sequence
Red=Cloning site Green=Tags(s) MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM LK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_037409 |
RefSeq Size | 3315 |
RefSeq ORF | 1896 |
Synonyms | CYK4; HsCYK-4; ID-GAP; MgcRacGAP |
Locus ID | 29127 |
UniProt ID | Q9H0H5 |
Cytogenetics | 12q13.12 |
Summary | This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH326045 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) | 10 ug |
$3,255.00
|
|
PH326046 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) | 10 ug |
$3,255.00
|
|
LC402238 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426645 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426646 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402238 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 | 100 ug |
$436.00
|
|
LY426645 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY426646 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 | 100 ug |
$436.00
|
|
TP307542 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP326045 | Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP326046 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.