RACGAP1 (NM_013277) Human Mass Spec Standard

SKU
PH307542
RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207542]
Predicted MW 71 kDa
Protein Sequence
Protein Sequence
>RC207542 protein sequence
Red=Cloning site Green=Tags(s)

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN
KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ
GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS
NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM
LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK
MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM
LK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037409
RefSeq Size 3315
RefSeq ORF 1896
Synonyms CYK4; HsCYK-4; ID-GAP; MgcRacGAP
Locus ID 29127
UniProt ID Q9H0H5
Cytogenetics 12q13.12
Summary This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RACGAP1 (NM_013277) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326045 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) 10 ug
$3,255.00
PH326046 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) 10 ug
$3,255.00
LC402238 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426645 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426646 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402238 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 100 ug
$436.00
LY426645 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 100 ug
$436.00
LY426646 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 100 ug
$436.00
TP307542 Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg 20 ug
$737.00
TP326045 Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP326046 Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.