RACGAP1 (NM_013277) Human Recombinant Protein

SKU
TP307542
Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207542 protein sequence
Red=Cloning site Green=Tags(s)

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN
KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ
GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS
NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM
LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK
MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM
LK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 70.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037409
Locus ID 29127
UniProt ID Q9H0H5
Cytogenetics 12q13.12
RefSeq Size 3315
RefSeq ORF 1896
Synonyms CYK4; HsCYK-4; ID-GAP; MgcRacGAP
Summary This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RACGAP1 (NM_013277) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307542 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409) 10 ug
$3,255.00
PH326045 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) 10 ug
$3,255.00
PH326046 RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) 10 ug
$3,255.00
LC402238 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426645 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426646 RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402238 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 100 ug
$436.00
LY426645 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 100 ug
$436.00
LY426646 Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 100 ug
$436.00
TP326045 Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP326046 Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.