TSPAN10 (NM_031945) Human Recombinant Protein

CAT#: TP307457

Recombinant protein of human tetraspanin 10 (TSPAN10), 20 µg

Product Images

Coomassie blue staining of purified TSPAN10 protein (Cat# TP307457). The protein was produced from HEK293T cells transfected with TSPAN10 cDNA clone (Cat# RC207457) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207457 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGTPKKGPAPSLS
  PGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDPMLGLALGGLVVSAASLAGCL
  GALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQDSLEHTLRVAIAHYQDDPDLRFLLDQVQLGL
  RCCGAASYQDWQQNLYFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCG
  PPLRRWLRANLAASGGYAIAVVLLQGAELLLAARLLGALAARSGAAYGPGARGEDRAGPQSPSPGAPPAA
  KPARG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114151
• Locus ID: 83882
• UniProt ID: Q9H1Z9, Q6PJ65, A0A087X235, F1T0E8
• Cytogenetics: 17q25.3
• Refseq Size: 1659
• Refseq ORF: 1065
• Synonyms: OCSP
• Summary: Regulates maturation of the transmembrane metalloprotease ADAM10.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane