OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EXTL2 (NM_001439) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307406
Recombinant protein of human exostoses (multiple)-like 2 (EXTL2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA356407 EXTL2 Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EXTL2 or NM_001439"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207406 protein sequence
Red=Cloning site Green=Tags(s)

MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIM
QTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPE
LETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSM
VLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGY
SGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001430
Locus ID 2135
UniProt ID Q9UBQ6
Cytogenetics 1p21.2
RefSeq Size 3217
RefSeq ORF 990
Synonyms EXTR2
Summary Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Transmembrane
Protein Pathways Heparan sulfate biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EXTL2" proteins (5)
SKU Description Size Price
PH307406 EXTL2 MS Standard C13 and N15-labeled recombinant protein (NP_001430) 10 ug
$3,360.00
LC419935 Lyophilized EXTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422342 Lyophilized EXTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419935 Transient overexpression lysate of exostoses (multiple)-like 2 (EXTL2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422342 Transient overexpression lysate of exostoses (multiple)-like 2 (EXTL2), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products