OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IMPDH1 (NM_183243) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307118
Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA351292 Rabbit Polyclonal Anti-IMPDH1 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IMPDH1 or NM_183243"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207118 protein sequence
Red=Cloning site Green=Tags(s)

MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQ
QLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFI
HHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSR
DIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNR
DYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIG
GNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVG
HVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQ
GVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEK
RLY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_899066
Locus ID 3614
UniProt ID P20839
Cytogenetics 7q32.1
RefSeq Size 2517
RefSeq ORF 1689
Synonyms IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608
Summary The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2008
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IMPDH1" proteins (13)
SKU Description Size Price
PH307118 IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_899066) 10 ug
$3,360.00
PH315206 IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_000874) 10 ug
$3,360.00
LC400315 Lyophilized IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405238 Lyophilized IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420173 Lyophilized IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428185 Lyophilized IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428186 Lyophilized IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400315 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY405238 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420173 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY428185 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY428186 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP315206 Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products