IMPDH1 (NM_000883) Human Mass Spec Standard

SKU
PH315206
IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_000874)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215206]
Predicted MW 64.1 kDa
Protein Sequence
Protein Sequence
>RC215206 representing NM_000883
Red=Cloning site Green=Tags(s)

MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESPRLDLATHPTTPRSELSSVVL
LAGVGVQMDRLRRASMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSAL
TRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSH
TVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLK
EANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQ
AGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQE
VMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDG
VRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARS
LSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000874
RefSeq Size 2880
RefSeq ORF 1797
Synonyms IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608
Locus ID 3614
UniProt ID P20839
Cytogenetics 7q32.1
Summary The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
Write Your Own Review
You're reviewing:IMPDH1 (NM_000883) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307118 IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_899066) 10 ug
$3,255.00
LC400315 IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405238 IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420173 IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428185 IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428186 IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400315 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1 100 ug
$665.00
LY405238 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2 100 ug
$436.00
LY420173 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3 100 ug
$665.00
LY428185 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7 100 ug
$436.00
LY428186 Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4 100 ug
$436.00
TP307118 Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315206 Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.