OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRB10 (NM_001001555) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306853
Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA812343 GRB10 mouse monoclonal antibody,clone OTI5A6 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GRB10 or NM_001001555"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206853 protein sequence
Red=Cloning site Green=Tags(s)

MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQ
QFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV
YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVT
WCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLAD
LEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR
IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL
HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE
DDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 60.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001555
Locus ID 2887
UniProt ID Q13322
Cytogenetics 7p12.1
RefSeq Size 5040
RefSeq ORF 1608
Synonyms Grb-10; GRB-IR; IRBP; MEG1; RSS
Summary The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Oct 2010
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRB10" proteins (11)
SKU Description Size Price
PH306853 GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555) 10 ug
$3,360.00
PH320822 GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001550) 10 ug
$3,360.00
LC417385 Lyophilized GRB10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424374 Lyophilized GRB10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424375 Lyophilized GRB10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424378 Lyophilized GRB10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417385 Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY424374 Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY424375 Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY424378 Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP320822 Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

Antigen-specificity of antiretinal antibodies in patients with noninfectious uveitis
Gibbs, Matsubara, Cao et al
Canadian Journal of Ophthalmology / Journal Canadien d'Ophtalmologie (2017)
Snippet: a trace of binding versus time. Pure recombinant human recoverin, S-antigen, IRBP, RPE65, TRYP1, and TRYP2 were commercially obtained (OriGene Technologies Inc;Rockville, Md.). Under conditions of continuous flow ... All 3 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products