GRB10 (NM_001001550) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC220822] |
Predicted MW | 60.8 kDa |
Protein Sequence |
Protein Sequence
>RC220822 protein sequence
Red=Cloning site Green=Tags(s) MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQ QFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVT WCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLAD LEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE DDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001001550 |
RefSeq Size | 4793 |
RefSeq ORF | 1608 |
Synonyms | Grb-10; GRB-IR; IRBP; MEG1; RSS |
Locus ID | 2887 |
UniProt ID | Q13322 |
Cytogenetics | 7p12.1 |
Summary | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH306853 | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555) | 10 ug |
$3,255.00
|
|
LC417385 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424374 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424375 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC424378 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417385 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 1 | 100 ug |
$665.00
|
|
LY424374 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 2 | 100 ug |
$665.00
|
|
LY424375 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 3 | 100 ug |
$665.00
|
|
LY424378 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 4 | 100 ug |
$436.00
|
|
TP306853 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP320822 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.