OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNC1LI2 (NM_006141) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306851
Recombinant protein of human dynein, cytoplasmic 1, light intermediate chain 2 (DYNC1LI2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA368211 DYNC1LI2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DYNC1LI2 or NM_006141"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206851 protein sequence
Red=Cloning site Green=Tags(s)

MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL
MTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMS
RPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENV
ALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNL
DLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKNSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN
EA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006132
Locus ID 1783
UniProt ID O43237
Cytogenetics 16q22.1
RefSeq Size 4352
RefSeq ORF 1476
Synonyms DNCLI2; LIC2
Summary Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 PubMed 7738094). See DYNC1H1 (MIM 600112) for general information about dyneins.supplied by OMIM, Mar 2008
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNC1LI2" proteins (3)
SKU Description Size Price
PH306851 DYNC1LI2 MS Standard C13 and N15-labeled recombinant protein (NP_006132) 10 ug
$3,360.00
LC416842 Lyophilized DYNC1LI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416842 Transient overexpression lysate of dynein, cytoplasmic 1, light intermediate chain 2 (DYNC1LI2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products