PDE1B (NM_000924) Human Recombinant Protein
CAT#: TP306588
Recombinant protein of human phosphodiesterase 1B, calmodulin-dependent (PDE1B), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206588 protein sequence
Red=Cloning site Green=Tags(s) MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000915 |
Locus ID | 5153 |
UniProt ID | Q01064, A0A024RB59 |
Cytogenetics | 12q13.2 |
Refseq Size | 3463 |
Refseq ORF | 1608 |
Synonyms | HEL-S-79p; PDE1B1; PDES1B |
Summary | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400337 | PDE1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431450 | PDE1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400337 | Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 1 |
USD 436.00 |
|
LY431450 | Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 2 |
USD 436.00 |
|
PH306588 | PDE1B MS Standard C13 and N15-labeled recombinant protein (NP_000915) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review