RAB27B (NM_004163) Human Recombinant Protein

CAT#: TP306519

Recombinant protein of human RAB27B, member RAS oncogene family (RAB27B), 20 µg

Product Images

Coomassie blue staining of purified RAB27B protein (Cat# TP306519). The protein was produced from HEK293T cells transfected with RAB27B cDNA clone (Cat# RC206519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL
  QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ
  REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK
  PPEKKCIC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004154
• Locus ID: 5874
• UniProt ID: O00194
• Cytogenetics: 18q21.2
• Refseq Size: 7003
• Refseq ORF: 654
• Synonyms: C25KG
• Summary: Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome