KRTAP3-2 (NM_031959) Human Recombinant Protein

CAT#: TP306391

Recombinant protein of human keratin associated protein 3-2 (KRTAP3-2), 20 µg

Product Images

Coomassie blue staining of purified KRTAP3-2 protein (Cat# TP306391). The protein was produced from HEK293T cells transfected with KRTAP3-2 cDNA clone (Cat# RC206391) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206391 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNS
  CQPTPGLETLNLTTFTQPCCEPCLPRGC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114165
• Locus ID: 83897
• UniProt ID: Q9BYR7
• Cytogenetics: 17q21.2
• Refseq Size: 749
• Refseq ORF: 294
• Synonyms: KAP3.2; KRTAP3.2
• Summary: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq, Jul 2008]