OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHYH (NM_006214) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306277
Recombinant protein of human phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350283 Rabbit Polyclonal Anti-PHYH Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PHYH or NM_006214"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206277 protein sequence
Red=Cloning site Green=Tags(s)

MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIK
NLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEIL
KYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLP
GTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISC
HFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006205
Locus ID 5264
UniProt ID O14832
Cytogenetics 10p13
RefSeq Size 1620
RefSeq ORF 1014
Synonyms LN1; LNAP1; PAHX; PHYH1; RD
Summary This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHYH" proteins (5)
SKU Description Size Price
PH306277 PHYH MS Standard C13 and N15-labeled recombinant protein (NP_006205) 10 ug
$3,360.00
LC416793 Lyophilized PHYH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421921 Lyophilized PHYH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416793 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421921 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products