PHYH (NM_006214) Human Mass Spec Standard

SKU
PH306277
PHYH MS Standard C13 and N15-labeled recombinant protein (NP_006205)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206277]
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC206277 protein sequence
Red=Cloning site Green=Tags(s)

MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIK
NLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEIL
KYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLP
GTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISC
HFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006205
RefSeq Size 1620
RefSeq ORF 1014
Synonyms LN1; LNAP1; PAHX; PHYH1; RD
Locus ID 5264
UniProt ID O14832
Cytogenetics 10p13
Summary This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PHYH (NM_006214) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416793 PHYH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421921 PHYH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416793 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1 100 ug
$436.00
LY421921 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 2 100 ug
$436.00
TP306277 Recombinant protein of human phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.