KCTD17 (NM_024681) Human Recombinant Protein
CAT#: TP306070
Recombinant protein of human potassium channel tetramerisation domain containing 17 (KCTD17), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206070 protein sequence
Red=Cloning site Green=Tags(s) MRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYL IDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVL QCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQL EEQQQQEEEVEEVEVEQVQVEADAQEKGSRPHPLRPEAELAVRASPRPLARPQSCHPCCYKPEAPGCEAP DHLQGLGVPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078957 |
Locus ID | 79734 |
UniProt ID | Q8N5Z5 |
Cytogenetics | 22q12.3 |
Refseq Size | 1707 |
Refseq ORF | 870 |
Summary | This gene encodes a protein that belongs to a conserved family of potassium channel tetramerization domain (KCTD)-containing proteins. The encoded protein functions in ciliogenesis by acting as a substrate adaptor for the cullin3-based ubiquitin-conjugating enzyme E3 ligase, and targets trichoplein, a keratin-binding protein, for degradation via polyubiquitinylation. A mutation in this gene is associated with autosomal dominant myoclonic dystonia 26. [provided by RefSeq, Nov 2016] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411141 | KCTD17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411141 | Transient overexpression lysate of potassium channel tetramerisation domain containing 17 (KCTD17) |
USD 436.00 |
|
PH306070 | KCTD17 MS Standard C13 and N15-labeled recombinant protein (NP_078957) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review