OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXA1 (NM_004496) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306045
Recombinant protein of human forkhead box A1 (FOXA1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FOXA1 or NM_004496"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206045 protein sequence
Red=Cloning site Green=Tags(s)

MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN
PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP
MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN
QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS
GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK
TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004487
Locus ID 3169
UniProt ID P55317
Cytogenetics 14q21.1
RefSeq Size 3396
RefSeq ORF 1416
Synonyms HNF3A; TCF3A
Summary This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXA1" proteins (3)
SKU Description Size Price
PH306045 FOXA1 MS Standard C13 and N15-labeled recombinant protein (NP_004487) 10 ug
$3,360.00
LC401427 Lyophilized FOXA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401427 Transient overexpression lysate of forkhead box A1 (FOXA1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Cooperative FOXA1–HNF4A binding emerges from motif spacing and nucleosome architecture
Wilson, Buck
bioRxiv (2026)
AI Summary: OriGene’s recombinant human full-length FOXA1 (TP306045) and HNF4A (TP317863) proteins were used in binding assays to investigate cooperative binding mechanisms between these transcription factors on nucleosomal DNA.
Snippet: Recombinant human full-length FOXA1 (Origene TP306045) and HNF4A (Origene TP317863) were used for binding reactions. … Binding reactions contained 30 nM purified nucleosome library and matched concentrations of FOXA1 and HNF4A at 0, 15, 30, 60, 120, and 240 nM in DNA-binding buffer (10 mM Tris–HCl pH 7.5, 50
Epigenetic memory of colitis promotes tumour growth
Nagaraja, Ojeda-Miron, Zhang et al
Nature (2026)
Cited by 28
AI Summary: In this study, OriGene’s recombinant FOS (TP760257), FOXP1 (TP313862), and FOXA1 (TP306045) proteins were used in in vitro assays to investigate how specific transcription factors contribute to the epigenetic memory of colitis in colonic stem cells.
Snippet: with the following modifications: briefly, selected sequences (25 ng per reaction) were incubated with various combinations of recombinant JUN (Active Motif, 31116), FOS (OriGene, TP760257), FOXP1 (OriGene, TP313862) and FOXA1 protein (OriGene, TP306045)
Quantifying genome-wide transcription factor binding affinities for chromatin using BANC-seq
Wester, Neikes, Lindeboom et al
Nat Protoc (2024)
Cited by 3
AI Summary: OriGene contributed to this study by providing the Flag-FOXA1 protein (cat. no. TP306045), which was used in BANC-seq experiments to quantify genome-wide transcription factor binding affinities in native chromatin.
Snippet: ments with Flag-YY1 (Active Motif, cat. no. 81119), Flag-SP1 (Active Motif, cat. no. 81181), Flag-FOXA1 (OriGene Technologies, cat. no. TP306045) and Flag-MYC/MAX (Active Motif, cat. no. 81087) Trypan blue ataining (Gibco
Quantification of absolute transcription factor binding affinities in the native chromatin context using BANC-seq
Neikes, Kliza, Gräwe et al
Nat Biotechnol (2023)
Cited by 29
AI Summary: OriGene's FLAG–FOXA1 protein (TP306045) was used in this study to assess transcription factor binding affinities in the BANC-seq method by adding it to isolated nuclei and measuring its concentration-dependent binding across the genome.
Snippet: … However, it is not yet possible to quantify the impact of chromatin Save;Recombinant FLAG–YY1 (Active Motif, 81119), FLAG–MYC/MAX (Active Motif, 81087), FLAG–SP1 (Active Motif, 81181) and FLAG–FOXA1 (OriGene Technologies, TP306045) were diluted to the highest tested concentration with double-distilled water or PSB and further diluted in PSB to ensure identical buffer conditions of all concentrations
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products