OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAMHD1 (NM_015474) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306013
Recombinant protein of human SAM domain and HD domain 1 (SAMHD1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502157 SAMHD1 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SAMHD1 or NM_015474"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206013 protein sequence
Red=Cloning site Green=Tags(s)

MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRE
NEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQ
FQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGH
GPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPV
EDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC
ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGEKKYRISTAIDDMEAYT
KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLD
VKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFVEQLIRVYCKKVDRK
SLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 72 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056289
Locus ID 25939
UniProt ID Q9Y3Z3
Cytogenetics 20q11.23
RefSeq Size 3189
RefSeq ORF 1878
Synonyms CHBL2; DCIP; HDDC1; hSAMHD1; MOP-5; SBBI88
Summary This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have been associated with Aicardi-Goutieres syndrome. provided by RefSeq, Mar 2010
Protein Categories Immune system diseases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAMHD1" proteins (3)
SKU Description Size Price
PH306013 SAMHD1 MS Standard C13 and N15-labeled recombinant protein (NP_056289) 10 ug
$3,360.00
LC414526 Lyophilized SAMHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414526 Transient overexpression lysate of SAM domain and HD domain 1 (SAMHD1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Conserved Herpesvirus Protein Kinases Target SAMHD1 to Facilitate Virus Replication
Zhang, Lv, Li
Cell Rep (2019) 28 (2), 449-459.e5 DOI: 10.1016/j.celrep.2019.04.020
AI Summary: OriGene’s human recombinant SAMHD1 protein (Cat# TP306013) was used in this study to investigate how herpesvirus protein kinases phosphorylate and inhibit SAMHD1, thereby facilitating viral replication.
Snippet: # P8010 TPA Fisher Scientific Cat# NC9325685 Sodium Butyrate (NaBu) Millipore Cat# 19137 Glutaraldehyde solution Sigma Cat# G7776 SAMHD1 human recombinant protein Origene Cat# TP306013 Critical Commercial Assays Halo-tag protein purification kit VWR/Promega Cat# PAG6790 Glutathione Sepharose 4B GE Healthcare Cat# 17–0756-01 Lipo
FigureFigureFigure
Conserved Herpesvirus Protein Kinases Target SAMHD1 to Facilitate Virus Replication
Zhang, Lv, Li
bioRxiv (2018)
Snippet: Page 1. 1 Conserved Herpesvirus Protein Kinases Target SAMHD1 to 1 Facilitate Virus Replication 2 3 4 5 6 7 Kun Zhang 1 , Dong-Wen Lv 1 and Renfeng Li 1,2,3,4* 8 9 1 Philips Institute for Oral Health Research, School of Dentistry;2 Department of Microbiology 10 View as HTML;The HA-tagged viral kinases (CHPKs) were gifts from Robert 377 Kalejta (Addgene plasmid #s 26689-26698) (Kuny et al., 2010). SAMHD1 clone (Cat# 378 SC114650) and recombinant SAMHD1 protein (Cat# TP306013) were purchased from Origene
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products