DBPA (YBX3) (NM_003651) Human Recombinant Protein

CAT#: TP305856

Recombinant protein of human cold shock domain protein A (CSDA), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified YBX3 protein (Cat# TP305856). The protein was produced from HEK293T cells transfected with YBX3 cDNA clone (Cat# RC205856) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205856 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA
  ASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET
  VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP
  ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP
  VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK
  EAKAGEAPTENPAPPTQQSSAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003642
• Locus ID: 8531
• UniProt ID: P16989, A0A024RAQ1
• Cytogenetics: 12p13.2
• Refseq Size: 1976
• Refseq ORF: 1116
• Synonyms: CSDA; CSDA1; DBPA; ZONAB
• Summary: Binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full-length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors
• Protein Pathways: Tight junction