DBPA (YBX3) Rabbit Polyclonal Antibody

SKU TA330132

Rabbit Polyclonal Anti-YBX3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: Y-box binding protein 3
• Database Link:
  NP_003642
  P16989
• Background: Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
• Synonyms: CSDA; CSDA1; DBPA; ZONAB
• Note: Immunogen sequence homology: Human: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Guinea pig: 84%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Tight junction