OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ribonuclease A (RNASE1) (NM_198235) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305620
Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA370722 RNASE1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ribonuclease A or NM_198235"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205620 protein sequence
Red=Cloning site Green=Tags(s)

MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP
VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG
SPYVPVHFDASVEDST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_937878
Locus ID 6035
UniProt ID P07998
Cytogenetics 14q11.2
RefSeq Size 903
RefSeq ORF 468
Synonyms RAC1; RIB1; RNS1
Summary This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Ribonuclease A" proteins (10)
SKU Description Size Price
PH305620 RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) 10 ug
$3,360.00
LC401024 Lyophilized RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404956 Lyophilized RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404957 Lyophilized RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404958 Lyophilized RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401024 Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY404956 Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404957 Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404958 Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP720748 Purified recombinant protein of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products