COMMD1 (NM_152516) Human Recombinant Protein

SKU TP305614

Recombinant protein of human copper metabolism (Murr1) domain containing 1 (COMMD1), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205614 protein sequence; Red=Cloning site Green=Tags(s); ; MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN; QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT; PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_689729
• Locus ID: 150684
• UniProt ID: Q8N668
• Cytogenetics: 2p15
• RefSeq Size: 725
• RefSeq ORF: 570
• Synonyms: C2orf5; MURR1
• Summary: COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]).[supplied by OMIM, Sep 2009]