OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305371
Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA358834 GPM6A Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Neuronal membrane glycoprotein M6 a or NM_201591"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205371 protein sequence
Red=Cloning site Green=Tags(s)

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD
TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA
WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT
FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_963885
Locus ID 2823
UniProt ID P51674
Cytogenetics 4q34.2
RefSeq Size 3697
RefSeq ORF 834
Synonyms GPM6; M6A
Summary Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G-protein-coupled receptors (GPCRs); enhances internalization and recycling of mu-type opioid receptor.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Neuronal membrane glycoprotein M6 a" proteins (11)
SKU Description Size Price
PH305371 GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) 10 ug
$3,360.00
PH305432 GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) 10 ug
$3,360.00
PH313529 GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886) 10 ug
$3,360.00
LC401623 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404475 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404476 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401623 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404475 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404476 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305432 Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1, 20 µg 20 ug
$737.00
TP313529 Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products