OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201592) Human Mass Spec Standard

Be the first to review this product
SKU
PH313529
GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358834 GPM6A Antibody - C-terminal region
100 ul
$585.00
LY401623 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Neuronal membrane glycoprotein M6 a or NM_201592"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213529
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC213529 representing NM_201592
Red=Cloning site Green=Tags(s)

MGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGDTLDVFTMIDIF
KYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLP
VYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGA
GAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963886
RefSeq Size 2962
RefSeq ORF 801
Synonyms GPM6; M6A
Locus ID 2823
UniProt ID P51674
Cytogenetics 4q34.2
Summary Involved in neuronal differentiation, including differentiation and migration of neuronal stem cells. Plays a role in neuronal plasticity and is involved in neurite and filopodia outgrowth, filopodia motility and probably synapse formation. GPM6A-induced filopodia formation involves mitogen-activated protein kinase (MAPK) and Src signaling pathways. May be involved in neuronal NGF-dependent Ca(2+) influx. May be involved in regulation of endocytosis and intracellular trafficking of G-protein-coupled receptors (GPCRs); enhances internalization and recycling of mu-type opioid receptor.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Neuronal membrane glycoprotein M6 a" proteins (11)
SKU Description Size Price
PH305371 GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) 10 ug
$3,360.00
PH305432 GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) 10 ug
$3,360.00
LC401623 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404475 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404476 Lyophilized GPM6A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401623 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404475 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404476 Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305371 Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2, 20 µg 20 ug
$737.00
TP305432 Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1, 20 µg 20 ug
$737.00
TP313529 Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products