OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MVB12B (NM_001011703) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305093
Recombinant protein of human family with sequence similarity 125, member B (FAM125B), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA335418 Rabbit Polyclonal Anti-MVB12B Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MVB12B or NM_001011703"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205093 protein sequence
Red=Cloning site Green=Tags(s)

MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVA
QTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVA
FRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSS
AASTPAPNLPR

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 24.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001011703
Locus ID 89853
UniProt ID Q9H7P6
Cytogenetics 9q33.3
RefSeq Size 2705
RefSeq ORF 663
Synonyms C9orf28; FAM125B
Summary The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2011
Protein Categories Growth Factors, Intracellular Proteins
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MVB12B" proteins (5)
SKU Description Size Price
PH305093 FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703) 10 ug
$3,360.00
LC409511 Lyophilized MVB12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423295 Lyophilized MVB12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409511 Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423295 Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products