OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MVB12B (NM_001011703) Human Mass Spec Standard

Be the first to review this product
SKU
PH305093
FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335418 Rabbit Polyclonal Anti-MVB12B Antibody
100 ul
$585.00
LY409511 Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MVB12B or NM_001011703"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205093
Predicted MW 24.5 kDa
Protein Sequence
Protein Sequence
>RC205093 protein sequence
Red=Cloning site Green=Tags(s)

MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVA
QTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVA
FRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSS
AASTPAPNLPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001011703
RefSeq Size 2705
RefSeq ORF 663
Synonyms C9orf28; FAM125B
Locus ID 89853
UniProt ID Q9H7P6
Cytogenetics 9q33.3
Summary The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2011
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MVB12B" proteins (5)
SKU Description Size Price
LC409511 Lyophilized MVB12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423295 Lyophilized MVB12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409511 Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423295 Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305093 Recombinant protein of human family with sequence similarity 125, member B (FAM125B), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products