ANKRD49 (NM_017704) Human Recombinant Protein

CAT#: TP304657

Recombinant protein of human ankyrin repeat domain 49 (ANKRD49), 20 µg

Product Images

Coomassie blue staining of purified ANKRD49 protein (Cat# TP304657). The protein was produced from HEK293T cells transfected with ANKRD49 cDNA clone (Cat# RC204657) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204657 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKM
  EKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVD
  GWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE
  TAFDIARRTSIYHYLFEIVEGCTNSSPQS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060174
• Locus ID: 54851
• UniProt ID: Q8WVL7, A0A024R398
• Cytogenetics: 11q21
• Refseq Size: 1924
• Refseq ORF: 717
• Synonyms: FGIF; GBIF
• Summary: Induces HBG1 expression (PubMed:16131492, PubMed:11162141). May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway (By similarity).[UniProtKB/Swiss-Prot Function]