PFDN2 (NM_012394) Human Recombinant Protein

  • Product Brand Image
SKU
TP304553
Recombinant protein of human prefoldin subunit 2 (PFDN2), 20 µg
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204553 protein sequence
Red=Cloning site Green=Tags(s)

MADNSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC
YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE
GAGAKASSAGVLVS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036526
Locus ID 5202
UniProt ID Q9UHV9
Cytogenetics 1q23.3
RefSeq Size 668
RefSeq ORF 462
Synonyms PFD2
Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "PFDN2" proteins (4)
SKU Description Size Price
PH304553 PFDN2 MS Standard C13 and N15-labeled recombinant protein (NP_036526) 10 ug
$3,360.00
LC415791 Lyophilized PFDN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415791 Transient overexpression lysate of prefoldin subunit 2 (PFDN2) (as WB positive control) 100 ug
$436.00
TP720227 Recombinant protein of human prefoldin subunit 2 (PFDN2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products