OriGene Logo

PFDN2 (NM_012394) Human Mass Spec Standard

Be the first to review this product
SKU
PH304553
PFDN2 MS Standard C13 and N15-labeled recombinant protein (NP_036526)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415791 Transient overexpression lysate of prefoldin subunit 2 (PFDN2) (as WB positive control)
100 ug
$436.00

Other products for "PFDN2 or NM_012394"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204553
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC204553 protein sequence
Red=Cloning site Green=Tags(s)

MADNSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKC
YRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSE
GAGAKASSAGVLVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036526
RefSeq Size 668
RefSeq ORF 462
Synonyms PFD2
Locus ID 5202
UniProt ID Q9UHV9
Cytogenetics 1q23.3
Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "PFDN2" proteins (4)
SKU Description Size Price
LC415791 Lyophilized PFDN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415791 Transient overexpression lysate of prefoldin subunit 2 (PFDN2) (as WB positive control) 100 ug
$436.00
TP304553 Recombinant protein of human prefoldin subunit 2 (PFDN2), 20 µg 20 ug
$867.00
TP720227 Recombinant protein of human prefoldin subunit 2 (PFDN2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.