CHIC2 (NM_012110) Human Recombinant Protein

SKU TP304420L

Recombinant protein of human cysteine-rich hydrophobic domain 2 (CHIC2), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204420 protein sequence; Red=Cloning site Green=Tags(s); ; MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR; VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK; CETNNMMEYVILIEFLPKTPIFRPD; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_036242
• Locus ID: 26511
• UniProt ID: Q9UKJ5
• Cytogenetics: 4q12
• RefSeq Size: 1178
• RefSeq ORF: 495
• Synonyms: BTL
• Summary: This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane