GJB3 (NM_001005752) Human Recombinant Protein

CAT#: TP304405

Recombinant protein of human gap junction protein, beta 3, 31kDa (GJB3), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified GJB3 protein (Cat# TP304405). The protein was produced from HEK293T cells transfected with GJB3 cDNA clone (Cat# RC204405) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204405 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFP
  ISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLI
  IEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLI
  CHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001005752
• Locus ID: 2707
• UniProt ID: O75712
• Cytogenetics: 1p34.3
• Refseq Size: 1777
• Refseq ORF: 810
• Synonyms: CX31; DFNA2; DFNA2B; EKV; EKVP1
• Summary: This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane