MRPL53 (NM_053050) Human Recombinant Protein

CAT#: TP304255

Recombinant protein of human mitochondrial ribosomal protein L53 (MRPL53), nuclear gene encoding mitochondrial protein, 20 µg

Product Images

Coomassie blue staining of purified MRPL53 protein (Cat# TP304255). The protein was produced from HEK293T cells transfected with MRPL53 cDNA clone (Cat# RC204255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGD
  GHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444278
• Locus ID: 116540
• UniProt ID: Q96EL3
• Cytogenetics: 2p13.1
• Refseq Size: 673
• Refseq ORF: 336
• Synonyms: L53MT
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 1p. [provided by RefSeq, Jul 2008]