PCTP (NM_021213) Human Recombinant Protein

SKU
TP304130
Recombinant protein of human phosphatidylcholine transfer protein (PCTP), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204130 protein sequence
Red=Cloning site Green=Tags(s)

MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD
IYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSM
PQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY
LKKT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067036
Locus ID 58488
UniProt ID Q9UKL6
Cytogenetics 17q22
RefSeq Size 2065
RefSeq ORF 642
Synonyms PC-TP; STARD2
Summary Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PCTP (NM_021213) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304130 PCTP MS Standard C13 and N15-labeled recombinant protein (NP_067036) 10 ug
$3,255.00
PH321070 PCTP MS Standard C13 and N15-labeled recombinant protein (NP_001095872) 10 ug
$3,255.00
LC412015 PCTP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412015 Transient overexpression lysate of phosphatidylcholine transfer protein (PCTP), transcript variant 1 100 ug
$436.00
TP321070 Recombinant protein of human phosphatidylcholine transfer protein (PCTP), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.