OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCTP (NM_021213) Human Mass Spec Standard

Be the first to review this product
SKU
PH304130
PCTP MS Standard C13 and N15-labeled recombinant protein (NP_067036)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365978 PCTP rabbit polyclonal antibody
100 ul
$310.00
LY412015 Transient overexpression lysate of phosphatidylcholine transfer protein (PCTP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PCTP or NM_021213"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204130
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC204130 protein sequence
Red=Cloning site Green=Tags(s)

MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD
IYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSM
PQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY
LKKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067036
RefSeq Size 2065
RefSeq ORF 642
Synonyms PC-TP; STARD2
Locus ID 58488
UniProt ID Q9UKL6
Cytogenetics 17q22
Summary Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCTP" proteins (5)
SKU Description Size Price
PH321070 PCTP MS Standard C13 and N15-labeled recombinant protein (NP_001095872) 10 ug
$3,360.00
LC412015 Lyophilized PCTP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412015 Transient overexpression lysate of phosphatidylcholine transfer protein (PCTP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304130 Recombinant protein of human phosphatidylcholine transfer protein (PCTP), transcript variant 1, 20 µg 20 ug
$867.00
TP321070 Recombinant protein of human phosphatidylcholine transfer protein (PCTP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products