NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

SKU TP303942

Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203942 representing NM_080678; Red=Cloning site Green=Tags(s); ; MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT; PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV; WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_542409
• Locus ID: 140739
• UniProt ID: Q969M7
• Cytogenetics: 2q37.3
• RefSeq Size: 1366
• RefSeq ORF: 555
• Synonyms: NCE2
• Summary: Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Ubiquitin mediated proteolysis