OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCE2 (UBE2F) (NM_080678) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303942
Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366396 UBE2F rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NCE2 or NM_080678"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s)

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT
PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV
WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542409
Locus ID 140739
UniProt ID Q969M7
Cytogenetics 2q37.3
RefSeq Size 1366
RefSeq ORF 555
Synonyms NCE2
Summary Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NCE2" proteins (3)
SKU Description Size Price
PH303942 UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409) 10 ug
$3,360.00
LC409102 Lyophilized UBE2F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409102 Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products