NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203942] |
Predicted MW | 20.9 kDa |
Protein Sequence |
Protein Sequence
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s) MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_542409 |
RefSeq Size | 1366 |
RefSeq ORF | 555 |
Synonyms | NCE2 |
Locus ID | 140739 |
UniProt ID | Q969M7 |
Cytogenetics | 2q37.3 |
Summary | Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC409102 | UBE2F HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409102 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) | 100 ug |
$436.00
|
|
TP303942 | Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.