NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard

SKU
PH303942
UBE2F MS Standard C13 and N15-labeled recombinant protein (NP_542409)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203942]
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC203942 representing NM_080678
Red=Cloning site Green=Tags(s)

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT
PDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVV
WGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542409
RefSeq Size 1366
RefSeq ORF 555
Synonyms NCE2
Locus ID 140739
UniProt ID Q969M7
Cytogenetics 2q37.3
Summary Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.[UniProtKB/Swiss-Prot Function]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:NCE2 (UBE2F) (NM_080678) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409102 UBE2F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409102 Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F) 100 ug
$436.00
TP303942 Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.