C1QC (NM_172369) Human Recombinant Protein
CAT#: TP303832
Recombinant protein of human complement component 1, q subcomponent, C chain (C1QC), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203832 protein sequence
Red=Cloning site Green=Tags(s) MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRG PKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRF NAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLR LQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_758957 |
Locus ID | 714 |
UniProt ID | P02747, A0A024RAA7 |
Cytogenetics | 1p36.12 |
Refseq Size | 1182 |
Refseq ORF | 735 |
Synonyms | C1Q-C; C1QG |
Summary | This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. [provided by RefSeq, Dec 2016] |
Protein Families | Secreted Protein |
Protein Pathways | Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403541 | C1QC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426451 | C1QC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403541 | Transient overexpression lysate of complement component 1, q subcomponent, C chain (C1QC), transcript variant 2 |
USD 436.00 |
|
LY426451 | Transient overexpression lysate of complement component 1, q subcomponent, C chain (C1QC), transcript variant 1 |
USD 436.00 |
|
PH303832 | C1QC MS Standard C13 and N15-labeled recombinant protein (NP_758957) |
USD 3,255.00 |
|
TP761200 | Purified recombinant protein of Human complement component 1, q subcomponent, C chain (C1QC), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review