OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303828
Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500641 Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Protein Kinase A regulatory subunit I alpha or NM_002734"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203828 protein sequence
Red=Cloning site Green=Tags(s)

MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK
AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH
LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP
RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ
KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL
DRPRFERVLGPCSDILKRNIQQYNSFVSLSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002725
Locus ID 5573
UniProt ID P10644
Cytogenetics 17q24.2
RefSeq Size 4325
RefSeq ORF 1143
Synonyms ACRDYS1; ADOHR; CAR; CNC; CNC1; PKR1; PPNAD1; PRKAR1; TSE1
Summary cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. provided by RefSeq, Jan 2013
Protein Categories Endocrine and metabolic diseases, Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Apoptosis, Insulin signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Protein Kinase A regulatory subunit I alpha" proteins (13)
SKU Description Size Price
PH303828 PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_002725) 10 ug
$3,360.00
PH310623 PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997636) 10 ug
$3,360.00
PH312810 PRKAR1A MS Standard C13 and N15-labeled recombinant protein (NP_997637) 10 ug
$3,360.00
LC400963 Lyophilized PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403944 Lyophilized PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403945 Lyophilized PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431006 Lyophilized PRKAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400963 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403944 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY403945 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431006 Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310623 Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, 20 µg 20 ug
$737.00
TP312810 Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

STK25 inhibits PKA signaling by phosphorylating PRKAR1A
Zhang, Wang, Kim et al
Cell Rep (2022) 40 (7), 111203 DOI: 10.1016/j.celrep.2022.111203
Cited by 15
AI Summary: OriGene's CRISPR-Cas9 gRNA vector (KN203215G) was used to generate STK25 knockout in human iPSCs, enabling the study of STK25's role in regulating PKA signaling by phosphorylating PRKAR1A.
Snippet: nsent before inclusion into the study. METHOD DETAILS CRISPR-Cas9 CRISPR-Cas9 Genome editing was used to generate a homozygous knockout of STK25 in WTC iPSCs following the manufacturer’s protocol (ORIGENE) with gRNA vector (KN203215G). Single-cell clones were expanded and confirmation of homozygous editing was determined by sanger sequencing of gDNA and protein analysis by western blot. iPS ca
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products