NPEPL1 (NM_024663) Human Recombinant Protein

CAT#: TP303704

Recombinant protein of human aminopeptidase-like 1 (NPEPL1), 20 µg

Product Images

Coomassie blue staining of purified NPEPL1 protein (Cat# TP303704). The protein was produced from HEK293T cells transfected with NPEPL1 cDNA clone (Cat# RC203704) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLY
  LNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIVMVCEQPEVFASACALARAFPLFTHRSGA
  SRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGI
  IPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGM
  KRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLA
  DGVSYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
  EFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRA
  SEDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078939
• Locus ID: 79716
• UniProt ID: Q8NDH3
• Cytogenetics: 20q13.32
• Refseq Size: 2217
• Refseq ORF: 1569
• Synonyms: bA261P9.2
• Summary: Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protease