PRKRIP1 (NM_024653) Human Recombinant Protein
CAT#: TP303379
Recombinant protein of human PRKR interacting protein 1 (IL11 inducible) (PRKRIP1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203379 protein sequence
Red=Cloning site Green=Tags(s) MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGS SAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLL AKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078929 |
Locus ID | 79706 |
UniProt ID | Q9H875, A0A024QYV5 |
Cytogenetics | 7q22.1 |
Refseq Size | 2181 |
Refseq ORF | 552 |
Synonyms | C114; KRBOX3 |
Summary | Required for pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:30705154). Binds double-stranded RNA. Inhibits EIF2AK2 kinase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411170 | PRKRIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411170 | Transient overexpression lysate of PRKR interacting protein 1 (IL11 inducible) (PRKRIP1) |
USD 436.00 |
|
PH303379 | PRKRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_078929) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review