PRKRIP1 (NM_024653) Human Recombinant Protein

CAT#: TP303379

Recombinant protein of human PRKR interacting protein 1 (IL11 inducible) (PRKRIP1), 20 µg

Product Images

Coomassie blue staining of purified PRKRIP1 protein (Cat# TP303379). The protein was produced from HEK293T cells transfected with PRKRIP1 cDNA clone (Cat# RC203379) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203379 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGS
  SAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLL
  AKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078929
• Locus ID: 79706
• UniProt ID: Q9H875, A0A024QYV5
• Cytogenetics: 7q22.1
• Refseq Size: 2181
• Refseq ORF: 552
• Synonyms: C114; KRBOX3
• Summary: Required for pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:30705154). Binds double-stranded RNA. Inhibits EIF2AK2 kinase activity (By similarity).[UniProtKB/Swiss-Prot Function]