OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BZW2 (NM_014038) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303310
Recombinant protein of human basic leucine zipper and W2 domains 2 (BZW2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308398 Rabbit polyclonal antibody to BZW2 (basic leucine zipper and W2 domains 2)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BZW2 or NM_014038"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203310 protein sequence
Red=Cloning site Green=Tags(s)

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFD
ILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFL
KAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKA
NLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVK
EEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYC
YDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_054757
Locus ID 28969
UniProt ID Q9Y6E2
Cytogenetics 7p21.1
RefSeq Size 1867
RefSeq ORF 1257
Synonyms HSPC028; MST017; MSTP017
Summary May be involved in neuronal differentiation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BZW2" proteins (6)
SKU Description Size Price
PH303310 BZW2 MS Standard C13 and N15-labeled recombinant protein (NP_054757) 10 ug
$3,360.00
LC415513 Lyophilized BZW2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431914 Lyophilized BZW2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415513 Transient overexpression lysate of basic leucine zipper and W2 domains 2 (BZW2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431914 Transient overexpression lysate of basic leucine zipper and W2 domains 2 (BZW2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP328886 Recombinant protein of human basic leucine zipper and W2 domains 2 (BZW2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products