OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C1D (NM_173177) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303301
Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "C1D or NM_173177"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203301 protein sequence
Red=Cloning site Green=Tags(s)

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK
S

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775269
Locus ID 10438
UniProt ID Q13901
Cytogenetics 2p14
RefSeq Size 1194
RefSeq ORF 423
Synonyms hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR
Summary The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.provided by RefSeq, Jun 2010
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C1D" proteins (7)
SKU Description Size Price
PH302688 C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324) 10 ug
$3,360.00
PH303301 C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269) 10 ug
$3,360.00
LC406634 Lyophilized C1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416720 Lyophilized C1D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406634 Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416720 Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302688 Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products