C1D (NM_173177) Human Recombinant Protein

CAT#: TP303301

Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified C1D protein (Cat# TP303301). The protein was produced from HEK293T cells transfected with C1D cDNA clone (Cat# RC203301) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203301 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
  LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK
  S
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775269
• Locus ID: 10438
• UniProt ID: Q13901
• Cytogenetics: 2p14
• Refseq Size: 1194
• Refseq ORF: 423
• Synonyms: hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR
• Summary: The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.[provided by RefSeq, Jun 2010]
• Protein Families: Druggable Genome
• Protein Pathways: RNA degradation