C1D (NM_006333) Human Mass Spec Standard

SKU PH302688

C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202688]
• Predicted MW: 16 kDa
• Protein Sequence:
  Protein Sequence

  >RC202688 protein sequence; Red=Cloning site Green=Tags(s); ; MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY; LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK; S; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006324
• RefSeq Size: 1207
• RefSeq ORF: 423
• Synonyms: hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR
• Locus ID: 10438
• UniProt ID: Q13901
• Cytogenetics: 2p14
• Summary: The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.[provided by RefSeq, Jun 2010]
• Protein Families: Druggable Genome
• Protein Pathways: RNA degradation